Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the PAC beta-lactamase family

PAC-1
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340.......350.......360.......370.......380.
MRCNKNVLSVVLLGALSLSAGNAFGQVSQADVDAVIRPLMSKYKIPGMAVALSVDGQHTFYNYGVASKATGQAVTPTTLFEIGSLSKTFTATLASYAQGQGKLQWSDQASHYLPSLKGSAFDRVTLLNLATHTSGMPLFVPDEVTNQEQLMAWYQAWQPTAPIGSQRVYSNLGIGMLGLITAQSLQKPFSEAMEQDLLAPLGMKHSWVKVPENQMAEYAQGYNKLDEPVRVTPGPPDAEAYGLKSSSADLLRWLDLNMAITPPSPAWQQAITETHKGYYQTGEFTQALIWEYYPWPTTKETLLAGNSSERIMKGLGAKPLTPPQAGPEQAWYNKTGSTNGFSTYAVFIPGQKTALILLANKWYPNDARIEAAYELVQRLKK
PAC-2 ...........................................Q........................................................................................................................................................................................................................................................................A.............................K..........................................  99.21 %
C-PAC phylogenetic tree

Last updated: December 22, 2025.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database was funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu

Live statistics (since March 29th, 2025)