Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the TEM beta-lactamase family

TEM-1
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......
-MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
TEM-2 -....................................K.........................................................................................................................................................................................................................................................  99.65 %
TEM-3 -....................................K................................................................K.....................................................................................................................................S..................................................  98.95 %
TEM-4 -..................F..................................................................................K.....................................................................................................................................S........................M.........................  98.60 %
TEM-5 -.................................................................................................................................................................S........................................................................T.K.................................................  98.95 %
TEM-6 -.....................................................................................................K...........................................................H............................................................................................................................  99.30 %
TEM-7 -....................................K............................................................................................................................S............................................................................................................................  99.30 %
TEM-8 -....................................K................................................................K...........................................................S.........................................................................S..................................................  98.60 %
TEM-9 -..................F..................................................................................K...........................................................S..................................................................................................M.........................  98.60 %
TEM-10 -.................................................................................................................................................................S..........................................................................K.................................................  99.30 %
TEM-11 -....................................K............................................................................................................................H............................................................................................................................  99.30 %
TEM-12 -.................................................................................................................................................................S............................................................................................................................  99.65 %
TEM-15 -.....................................................................................................K.....................................................................................................................................S..................................................  99.30 %
TEM-16 -....................................K................................................................K...........................................................H............................................................................................................................  98.95 %
TEM-17 -.....................................................................................................K........................................................................................................................................................................................  99.65 %
TEM-19 -...........................................................................................................................................................................................................................................S..................................................  99.65 %
TEM-20 -...................................................................................................................................................................................T.......................................................S..................................................  99.30 %
TEM-21 -....................................K................................................................K................................................R....................................................................................S..................................................  98.60 %
TEM-22 -....................................K................................................................K....................................................................................................................................GS..................................................  98.60 %
TEM-24 -....................................K................................................................K...........................................................S........................................................................T.K.................................................  98.25 %
TEM-26 -.....................................................................................................K...........................................................S............................................................................................................................  99.30 %
TEM-28 -.................................................................................................................................................................H..........................................................................K.................................................  99.30 %
TEM-29 -.................................................................................................................................................................H............................................................................................................................  99.65 %
TEM-30 -................................................................................................................................................................................................................................................S.............................................  99.65 %
TEM-31 -................................................................................................................................................................................................................................................C.............................................  99.65 %
TEM-32 -..................................................................I................................................................................................................T..........................................................................................................  99.30 %
TEM-33 -..................................................................L...........................................................................................................................................................................................................................  99.65 %
TEM-34 -..................................................................V...........................................................................................................................................................................................................................  99.65 %
TEM-35 -..................................................................L............................................................................................................................................................................................................D..............  99.30 %
TEM-36 -..................................................................V............................................................................................................................................................................................................D..............  99.30 %
TEM-37 -..................................................................I............................................................................................................................................................................................................D..............  99.30 %
TEM-39 -..................................................................L...............................................................................................R............................................................................................................D..............  98.95 %
TEM-40 -..................................................................I...........................................................................................................................................................................................................................  99.65 %
TEM-43 -.....................................................................................................K...........................................................H.................T..........................................................................................................  98.95 %
TEM-45 -..................................................................L...........................................................................................................................................................................................................Q...............  99.30 %
TEM-47 -...........................................................................................................................................................................................................................................SK.......................M.........................  98.95 %
TEM-48 -..................F........................................................................................................................................................................................................................SK.......................M.........................  98.60 %
TEM-49 -..................F........................................................................................................................................................................................................................SK.......................M..G......................  98.25 %
TEM-52 -.....................................................................................................K.............................................................................T.......................................................S..................................................  98.95 %
TEM-53 -..................F..............................................................................................................................................S............................................................................................................................  99.30 %
TEM-54 -................................................................................................................................................................................................................................................L.............................................  99.65 %
TEM-55 -.......................................................................................................................................................................................................................E......................................................................  99.65 %
TEM-57 -.........................................................................................D....................................................................................................................................................................................................  99.65 %
TEM-60 -....................................K...........P....................................................K...........................................................S......................R...................................C......L..........................................................  97.55 %
TEM-61 -....................................K............................................................................................................................H..........................................................................K.................................................  98.95 %
TEM-63 -..................F..................................................................................K...........................................................S.................T..........................................................................................................  98.60 %
TEM-67 -..................I.................K...........................................................................................................................................................................................................C.............................................  98.95 %
TEM-68 -...........................................................................................................................................................................................................................................SK.......................M.........L...............  98.60 %
TEM-70 -.........................................................................................................................................................................................................Q....................................................................................  99.65 %
TEM-71 -...........................................................................................................................................................................................................................................SK.................................................  99.30 %
TEM-72 -....................................K..............................................................................................................................................T.......................................................SK.................................................  98.60 %
TEM-76 -...............................................................................................................................G..............................................................................................................................................................  99.65 %
TEM-77 -..................................................................L.............................................................................................................................................................................S.............................................  99.30 %
TEM-78 -..................................................................V...............................................................................................R............................................................................................................D..............  98.95 %
TEM-79 -................................................................................................................................................................................................................................................G.............................................  99.65 %
TEM-80 -..................................................................L.........................................................V..................................................................................................................................................D..............  98.95 %
TEM-81 -..................................................................L.........................................................V.................................................................................................................................................................  99.30 %
TEM-82 -..................................................................V...........................................................................................................................................................................................................Q...............  99.30 %
TEM-83 -..................................................................L...............................................................................................C...........................................................................................................Q...............  98.95 %
TEM-84 -...............................................................................................................................................................................................................................................................................D..............  99.65 %
TEM-85 -..................F..............................................................................................................................................S..........................................................................K.......................M.........................  98.60 %
TEM-86 -..................F..............................................................................................................................................S........................................................................T.K.......................M.........................  98.25 %
TEM-87 -...K.................................................................................................K..........................................................HC.................T..........................................................................................................  98.25 %
TEM-88 -.....................................................................................................K.............................................................................T.............D.........................................S..................................................  98.60 %
TEM-90 -................................................................................................................G.............................................................................................................................................................................  99.65 %
TEM-91 -.................................................................................................................................................................C.................T........................................................K.................................................  98.95 %
TEM-92 -...K.................................................................................................K.............................................................................T.......................................................S..................................................  98.60 %
TEM-93 -...................................................................................................................................................................................T.......................................................SK.................................................  98.95 %
TEM-94 -..................F..................................................................................K.............................................................................T.......................................................S........................M.........................  98.25 %
TEM-95 -..............................................................................................................................................A...............................................................................................................................................  99.65 %
TEM-96 -................................................................................................................................................................G.............................................................................................................................  99.65 %
TEM-97 -.DP...............................................................V.........................................................................................................................................................................................................................L.  98.60 %
TEM-98 -.DP.........................................................................................................................................................................................................................................................................................L.  98.95 %
TEM-99 -.DP.............................................................................................................................................................................................................................................S...........................................L.  98.60 %
TEM-101 -....................................K......................................................................................................................................................................................................SK......................................V..........  98.60 %
TEM-102 -......................VR.............................................................................................................................................................V................................................................V.......................................  98.60 %
TEM-103 -..............................................................................................................................................................................................................................................................................L...............  99.65 %
TEM-104 -...................................................................................................................................................................................................................................................................................V..........  99.65 %
TEM-105 -.........................................................................................................................N....................................................................................................................................................................  99.65 %
TEM-106 -.....................................................................................................K.............................................................................T..........................................................................................................  99.30 %
TEM-107 -.....................................................................................................K...........................................................H.................T.......................................................S..................................................  98.60 %
TEM-108 -.DP..........................................................................E...................................................................................................................S.............................................................................S..............  98.25 %
TEM-109 -..................................................................L..................................K...........................................................H............................................................................................................................  98.95 %
TEM-110 -..................F.................................................................................................................................................................................................................................................M.........................  99.30 %
TEM-111 -.....................................................................................................K.....................................................................................................................................D........................M.........................  98.95 %
TEM-112 -......................................................................................................................................................R....................................................................................S..................................................  99.30 %
TEM-113 -....................................K................................................................K.............................................................................T.......................................................S..................................................  98.60 %
TEM-114 -....................................K............................................................................................................................S........................................................................T.K.................................................  98.60 %
TEM-115 -..................F..............................................................................................................................................H............................................................................................................................  99.30 %
TEM-116 -.................................................................................I...................................................................................................V........................................................................................................  99.30 %
TEM-117 -..................F...........................................................................................................................................................................................................................................................................  99.65 %
TEM-120 -..................F........................................................................................................................................................................................................................S..................................................  99.30 %
TEM-121 -....................................K................................................................K...........................................................S........................................................................T.K...S.............................................  97.90 %
TEM-122 -..............................................................................................................................................................................................................................................................................Q...............  99.65 %
TEM-123 -...K.................................................................................................K.....................................................................................................................................S........-.........................A...............  98.25 %
TEM-124 -...K.................................................................................................K.............................................................................T................................................................-.........................A...............  98.25 %
TEM-125 -.............L....................................................L..............................................................................................SR............................................................................................................D..............  98.25 %
TEM-126 -................................................................................................................................................................................E..T..........................................................................................................  99.30 %
TEM-127 -...........................................................................................................................................................N..................................................................................................................................  99.65 %
TEM-128 -..........................................................................................................................................................E...................................................................................................................................  99.65 %
TEM-129 -....................................K................................................................K...........................................................S............................................................................................................................  98.95 %
TEM-130 -................................P...K................................................................K...........................................................S........................................................................T...................................................  98.25 %
TEM-131 -..................F..................................................................................K...........................................................S.................T......................................................T...................................................  98.25 %
TEM-132 -.................................................................................................................................................................H........V.................................................................K.................................................  98.95 %
TEM-133 -..................F..................................................................................K...........................................................S............................................................................................................................  98.95 %
TEM-134 -....................................K................................................................K...........................................................H.........................................................................S..................................................  98.60 %
TEM-135 -...................................................................................................................................................................................T..........................................................................................................  99.65 %
TEM-136 -.................................................................................................................................................................S........................................................................T.K..........................G......................  98.60 %
TEM-137 -.................................................................................................................................................................S..........................................................................R.................................................  99.30 %
TEM-138 -.....................................................................................................K......................................................................I..............................................................S..................................................  98.95 %
TEM-139 -....................................K.........M......................................................K.....................................................................................................................................S..................................................  98.60 %
TEM-141 -...............................E..............................................................................................................................................................................................................................................................  99.65 %
TEM-142 -.....................................................................................................K.....................................................................................................................................N........................M.........................  98.95 %
TEM-143 -.................................................................................................................................................................C............................................................................................................................  99.65 %
TEM-144 -.................................................................................................................................................................C..........................................................................K.................................................  99.30 %
TEM-145 -..........................................................................................................................................................................................................................M.....................H.............................................  99.30 %
TEM-146 -...............................................................................................................P................................................................................................................................H.............................................  99.30 %
TEM-147 -.................................................................................................................................................................H...........................................................V................................................................  99.30 %
TEM-148 -.........................................................................................................................................................................................K....................................................................................................  99.65 %
TEM-149 -.....................................................................................................K...........................................................S.................T........................................................V.................................................  98.60 %
TEM-150 -.........................D....................................................................................................................................................................................................................................................................  99.65 %
TEM-151 -..................................................................V..............................................................................................H.............................................................................................................D.......G......  98.60 %
TEM-152 -..................................................................V..............................................................................................H..........................................................................K..................................D..............  98.60 %
TEM-153 -.....................................................................................................K.............................................................................T..................................................................................V.......................  98.95 %
TEM-154 -..................................................................L..............................................................................................S............................................................................................................................  99.30 %
TEM-155 -....................................K............................................................................................................................S..........................................................................K.................................................  98.95 %
TEM-156 -........................................................................................................................................................I.....................................................................................................................................  99.65 %
TEM-157 -.................................................................................I...............S...................................................................................V........................................................................................................  98.95 %
TEM-158 -..................................................................L..............................................................................................S.............................................................................................................D..............  98.95 %
TEM-159 -..................F...............................................I................................................................................................................T..........................................................................................................  98.95 %
TEM-160 -....................................K.............................V...........................................................................................................................................................................................................................  99.30 %
TEM-162 -.........................K.........N.........................K...................I...............S.V.................................................................................V........................................................................................................  97.55 %
TEM-163 -..............................................................................................................................................................................................................................................................................Q.............L.  99.30 %
TEM-164 -.....................................V............................................................................................................................................................................................................................................T...........  99.30 %
TEM-166 -.....................................................................................................................G........................................................................................................................................................................  99.65 %
TEM-167 -..................F..................................................................................K.......................................................................................................................V.............S........................M.........................  98.25 %
TEM-168 -....................................................................................................................................................................................................................................................................M.........................  99.65 %
TEM-169 -..................................................................L...............................................................................................G...........................................................................................................................  99.30 %
TEM-171 -.................................................................................I............................................................................................................................................................................................................  99.65 %
TEM-176 -.............................................................................................................................................................................................................................V................................................................  99.65 %
TEM-177 -...K................................K................................................................K...........................................................S.................T......................................................T.K.................................................  97.55 %
TEM-178 -.......................................STS....................................................................................................SQ...............................A.................................A-........................R..................................................  96.85 %
TEM-181 -.....................................................................................................................................................................................V........................................................................................................  99.65 %
TEM-182 -..................................................................I...............................................................................................L...........................................................................................................L...............  98.95 %
TEM-183 -...................................................................................................................................................................................................................................L..........................................................  99.65 %
TEM-184 -...K.................................................................................................K......................V....................................S.................T..........................................................................................................  98.25 %
TEM-185 -..................................................................L...............................................................................................R...........................................................................................................................  99.30 %
TEM-186 -.............................................................................................................................................................................N................................................................................................................  99.65 %
TEM-187 -..................F..............................................................................................................................................H...................V..............................................................................M........................-  98.25 %
TEM-188 -..................F........................................................................................................................................................................................................................SK.................................................  98.95 %
TEM-189 -..................................................................L.........................................................................................................................................................................K.................................................  99.30 %
TEM-190 -..................................................................L...............................................................................................G............................................................................................................D..............  98.95 %
TEM-191 -............................................................................................................................................................................................................................................K.................................................  99.65 %
TEM-193 -.....................................................................................................................................H.F.........................C.G.K.T....H..........V.N...............................I....................................................................  96.50 %
TEM-194 -................................................................................................R.....................................I..................R..................H.........PV.....T...V........PR.............I....................................................................  96.15 %
TEM-195 -................................................................................................R................................................................C..........H..........V......................................................................................................  98.60 %
TEM-196 -......................................................F.......................................................................................................................................................................................................................................  99.65 %
TEM-197 -.....................................................................................................K...............................................................................V.....................................................S..................................................  98.95 %
TEM-198 -..........................................................................................................................................................................................................................................................................I...................  99.65 %
TEM-201 -...........................V...........................................................................................................................................................................................................................................G......................  99.30 %
TEM-204 -...K.................................................................................................K...........................................................H.................T.......................................................S..................................................  98.25 %
TEM-205 -.................................................................................I...................K...........................................................S.................T.V........................................................................................................  98.25 %
TEM-206 -........T.....................................................................................................................................................................................................................................................................................  99.65 %
TEM-207 -............................................................................................................................................................................................................................................G.................................................  99.65 %
TEM-208 -...................................................................................................F..........................................................................................................................................................................................  99.65 %
TEM-209 -......................................D.......................................................................................................................................................................................................................................................  99.65 %
TEM-210 -..............................................M...................L...........................................................................................................................................................................................................................  99.30 %
TEM-211 -...K.................................................................................................K.........................T...................................................T.......................................................S..................................L...............  97.90 %
TEM-212 -......................................................................................................N.......................................................................................................................................................................................  99.65 %
TEM-213 -......................................................................................................F.......................................................................................................................................................................................  99.65 %
TEM-214 -..........F...................................................................................................................................................................................................................................................................................  99.65 %
TEM-215 -......................................................................................................................................................R.......................................................................................................................................  99.65 %
TEM-216 -........S...............................P.....................................................................................................................................................................................................................................................  99.30 %
TEM-217 -..................................................................................................................................................................................................................................................................M...........................  99.65 %
TEM-219 -.................................................................................................................................................................................................................................................................F............................  99.65 %
TEM-220 -...................................................................................................................................................................................T..T.......................................................................................................  99.30 %
TEM-224 -...K.................................................................................................K.........................T.................................S.................T..........................................................................................................  98.25 %
TEM-225 -.....................................................................................................K.............................................................................T.......................................................S.............................V....................  98.60 %
TEM-226 -.....................................................................................................K.......................................................................................................................V.............S..................................................  98.95 %
TEM-227 -....................................K................................................................K..........N..........................................................................................................................S...........................................T......  98.25 %
TEM-228 -......................................................................................................................................................................................T.......................................................................................................  99.65 %
TEM-229 -.................................................................................I...................................................................................................V.........................................................................V..............................  98.95 %
TEM-230 -........................................................................................................................................................................................................................................T...........................M.........................  99.30 %
TEM-231 -...................................................................................................................................................................................I..........................................................................................................  99.65 %
TEM-232 -..............................................................S..................................................................................................S............................................................................................................................  99.30 %
TEM-233 -.......................................................................................H..............SP......................................................................................................................................................................A...............  98.60 %
TEM-234 -.........................................................................................................................................................................................................................................................................S....................  99.65 %
TEM-235 -.....................................................................................................................................................................................................................................D........................................................  99.65 %
TEM-236 -.................................................................................................................................................................C.................T..........................................................................................................  99.30 %
TEM-237 -.......................................................................................................................................................................................................................................................................G......................  99.65 %
TEM-238 -..................................................................I...............................................................................................R................T..........................................................................................................  98.95 %
TEM-239 MSIQ.Y.........................................................................................................................................................................................................................................................................................  98.26 %
TEM-240 -...................................................................................................................................................................................T.........................................................H................................................  99.30 %
TEM-241 -....................................K.................................................................................................................R..........H............................................................................................................................  98.95 %
TEM-242 -.....................................................................................................K...........................................................S.................T..........................................................................................................  98.95 %
TEM-243 -.........RR...................................................................................................................................................................................................................................................................................  99.30 %
TEM-244 -.........................A....................................................................................................................................................................................................................................................................  99.65 %
TEM-245 -....................................................................................................................................................................S.........................................................................................................................  99.65 %
TEM-246 -...................H................................................................W.........................................................................................................................................................................................................  99.30 %
TEM-247 -.......................................................................................................................................F......................................................................................................................................................  99.65 %
TEM-248 -...........................V..................................................................................................................................................................................................................................................................  99.65 %
TEM-249 -............................................................................................................................................................................................................................................................................................D.  99.65 %
TEM-P14 -----------.......................................................I...................................................................................................................................................................................................-------------------------  87.41 %
TEM-P114 -....................................K..........................................................................................G.....................................................................................................................................................---------  96.15 %
TEM-P116 ----.................................K..V...................................................................................................................................................................................................SK.......................M.......................--  96.50 %
TEM-P117 -------------......F..............................................................................................................................................H..................................................................................................M............-------------  90.21 %
TEM-P118 -------------.....................................................................................................................................................H..................................................................................................M............-------------  90.56 %
TEM-P120 -....................................K................................................................K.........................G...........................................................................................................S..........................................--------  95.80 %
TEM-P121 ----.................................K................................................................K..................................................I..................................................................................S..................................................  97.55 %
A-TEM phylogenetic tree

Last updated: November 16, 2022.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu