Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the SGM beta-lactamase family

SGM-1
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320......
-----MKIVTALGALALLAAPASAADRQKTPAQEPAPTGNLDNLMPAAPRYLVPQSALEQVRNPKEIEEETGGRLGVALVDRQGALLLGFNRDERFAMCSTFKAPLAAAVLTGADGGKFGLEGTIPFGKEDVLDYAPVVKKNLKRGRMSMEELARAAVEVSDNSAANLLLPMLGGPEGLTAFMRVHGDDVTRLDRTEPALNENAEGDPRDTTTPAAMAGLMARLFFRDLKAESADRLRAWFNASSTGDKRIKAGLPEGWTSGSKTGSCGTAYNDVALVKSPTGEEYILAIYLDRPTIDAKKAEAAIAEAARAALNFVGQARKSGLE
SGM-2 --MPRRL----IF.AL......A.-----------QQEAPRQS.L.PP...M.SE..MKS........T.S..........GK...I........................A..E........Q.S.A.A.L.......R..V...........A.................V.......R.I.A...M......N..S........E....S........G..I....AP...GK..G.L...T..AN.......K..I...................A.S..............V...A.......T.....D..DK.Q.T...  72.53 %
SGM-3 --MPRRL----IF.AL......A.-----------QQEAPRPS.L.PP...M.SE..MRS........T.S..........GK...I........................A..E........Q.S.A.A.L.......R..V...........A.................V.......R.I.A.D.M......N..S........E....S........G..I....AP...GK..G.L...T..AN.......K......................A.S..............V...A.......T.....D..DK.Q.T...  72.53 %
SGM-4 --MPRRL----.L.AL...G....-----------QQEAPRQS.L.PP...M.SE..MKS........S.S..........SK...I........................S..E.N......Q.G.T.A.L..H.......AR..........A.................I.....F.RYV.A...N..................E....S........R..I.T...P...A...G.L...T..GN.......KD........T............A.S..............V...A.......T.....D...K.Q.T...  72.53 %
SGM-5 MAVRKSLSFA..T.CL.V.M.L...PKK.A..KKAEDVPV.PTQL.P...........TS..............M.I.....D...I......D.................I..E......D.E...T.D.I..........R.......A...Q.............................A...KI.....N.......I...G....S........S..L...MQ.AD.....G.L...T..................................A.S..............V.Q.A.........HS..E..SK.K....D  76.07 %
SGM-6 MALRKSLSLA..T.CLVVTL.L...PKK.A..KKAEEVPT.PT...P...........TS..............M.I.....E...I......D.................I..Q........E...T.D.I..........K.......A...E.........................S.I.A...KI.....I..E....VA.......S........G..L...MQ.AD.....G.L...T....................................A..............V.D...........HS..E..SK.Q....D  76.07 %
SGM-7 MALRKSLSLA..T.CLVV.L.L...PKK.A..KKVEEVPT.PT.L.P...........TS..............M.I.....E...I......D.................I..Q........E...T.D.I..........K.......A...A.........................S.I.A...KI.....I..D....IA.......S........G..L...MA.AD.....G.L...T....................................A..............V.D...........HS..E..SK.Q....N  76.07 %
A-SGM phylogenetic tree

Last updated: November 06, 2021.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu