Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the ROB beta-lactamase family

ROB-1
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.
MLNKLKIGTLL-----LLTLTACSPNSVHSVTSNPQPASAPVQQSATQATFQQTLANLEQQYQARIGVYVWDTETGHSLSYRADERFAYASTFKALLAGAVLQSLPEKDLNRTISYSQKDLVSYSPETQKYVGKGMTIAQLCEAAVRFSDNSATNLLLKELGGVEQYQRILRQLGDNVTHTNRLEPDLNQAKPNDIRDTSTPKQMAMNLNAYLLGNTLTESQKTILWNWLDNNATGNPLIRAATPTSWKVYDKSGAG-KYGVRNDIAVVRIPNRKPIVMAIMSTQFTEEAKFNNKLVEDAAKQVFHTLQLN
ROB-2 .F.........-----........L........................................................................................................................................................................................................................................-.....................................................  99.34 %
ROB-3 ...........LLT---...................................................................................................................................................................A............................................................................-.....................................................  98.38 %
ROB-4 ...........LLT---...................................................................................................................................................................A............................................................................-.........................................T...........  98.05 %
ROB-5 .F.........-----.......................................................................................................................................T............................A............................................................................-.....................................................  99.02 %
ROB-6 ...........-----.......L..F...........................S..........................................................................................................................................................................................................-.....................................................  99.02 %
ROB-7 ...........-----.......L....L....................................................................................................................................................................................................................................-.....................................................  99.34 %
ROB-8 ...........-----.......L....P.........................S..........................................................................................................................................................................................................-.....................................................  99.02 %
ROB-9 ...........-----...............K....................................................................................................................................................A............................................................................K.....................................................  99.02 %
ROB-10 .F.........-----....................................................................................................................................................................A............................................................................-.....................................................  99.34 %
ROB-11 ...........-----....................................................................................................................................................................A............................................................................-.....................................................  99.67 %
ROB-12 ...........LLTLL....................................................................................................................................................................A............................................................................-.....................................................  98.06 %
A-ROB phylogenetic tree

Last updated: November 06, 2021.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu