Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the OXY-6-like beta-lactamase family

OXY-6-1
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.
MLKSSWRKSALMAAAAVPLLLASGSLWASADAIQQKLADLEKRSGGRLGVALINTADDSQTLYRGDERFAMCSTGKVMAAAAVLKQSESHPDVVNKRLEIKKSDLVVWSPITEKHLQSGMTLAELSAAALQYSDNTAMNKMISYLGGPEKVTAFAQSIGDVTFRLDRTEPALNSAIPGDKRDTTTPLAMAESLRKLTLGNALGEQQRAQLVTWLKGNTTGGQSIRAGLPASWAVGDKTGAGDYGTTNDIAVIWPENHAPLVLVTYFTQPQQDAKSRKEVLAAAAKIVTEGL
OXY-6-2 .............-.....................................................................................................................................................................................................................................................................................  99.66 %
OXY-6-3 .......................................................T...........................................................................................................................................................................................................................................  99.66 %
OXY-6-4 ......................................N............................................................................................................................................................................................................................................................  99.66 %
OXY-6-5 .............-........................................................................................................................................................................................................................N............................................................  99.31 %
OXY-6-6 .....................................TN......................................................L.....................................................................................................................................................................................................  98.97 %
OXY-6-7 ......................................N......................................................L.....................................................................................................................................................................................................  99.31 %
OXY-6-8 ...................................................................................................................P...............................................................................................................................................................................  99.66 %
OXY-6-9 ......................................N...........................................................................................................................................................................................D................................................................  99.31 %
OXY-6-10 ......................................N...............................................................................................................................................................V............................................................................................  99.31 %
OXY-6-11 ..................................................................................................................................................................................................................M................................................................................  99.66 %
A-OXY-6-like phylogenetic tree

Last updated: November 16, 2022.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu