Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the OXY-2-like beta-lactamase family

OXY-2-1
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280..........
MIKSSWRKIAMLAAAVPLLLASGALWASTDAIHQKLTDLEKRSGGRLGVALINTADNSQILYRGDERFAMCSTSKVMAAAAVLKQSESNKEVVNKRLEINAADLVVWSPITEKHLQSGMTLAELSAATLQYSDNTAMNLIIGYLGGPEKVTAFAHSIGDATFRLDRTEPTLNTAIPGDERDTSTPLAMAESLRKLTLGDALGEQQRAQLVTWLKGNTTGGQSIRAGLPESWVVGDKTGAGDYGTTNDIAVIWPEDHAPLVLVTYFTQPQQDAKNRKEVLAAAAKIVTEGL
OXY-2-2 ..........................................................................................................................................................R........................................................................................................I..............................  99.31 %
OXY-2-3 .............-............................................................................................................................................R...................................................................................G...................................................  98.97 %
OXY-2-4 .............-............................................................................................................................................R.......................................................................................................................................  99.31 %
OXY-2-5 ..........................................................................................................................................................R.............S.....................................................................S...................................................  98.97 %
OXY-2-6 ......................S...................................................................................................................................R.......................................................................................................................................  99.31 %
OXY-2-7 ..........................................................................................................................................................R.......................................................................................................................................  99.66 %
OXY-2-8 ......................S...................................................................................................................................R...........................................N.......................................................N...................................  98.62 %
OXY-2-9 .............-............................................................................................................................................R...................................................................................T...................................................  98.97 %
OXY-2-10 ..........................................................................................................................................................R...................................................................................................N...........................T.......  98.97 %
OXY-2-11 ..........................................................................................................................................................R...........................................N...........................................................................................  99.31 %
OXY-2-12 ..........................................................................................................................................................R...................................................................................................N...................................  99.31 %
OXY-2-13 ..............................................................................................................................................H...................................................................................................................................................  99.66 %
OXY-2-14 ..........................................................................................................................................................R...................................................................................S...................................................  99.31 %
OXY-2-15 ..........................................................................................................................................................R..............--........................................................................................I..............................  98.62 %
OXY-2-16 .....................................A....................................................................................................................R...........................................N.......................................................N...................................  98.62 %
OXY-2-17 .................................................................................................D........................................................R...................................................................................................N...........................T.......  98.62 %
OXY-2-18 ..........................................................................................................................................................R...........................................N.......................................................N...................................  98.97 %
OXY-2-19 ..........................................................................................................................................................R...................................................................................G...................................................  99.31 %
OXY-2-20 ......................S...................................................................................................................................R...........................................N.......................................................N...........................T.......  98.28 %
OXY-2-21 ..........I...............................................................................................................................................R...........................................N...........................................................................................  98.97 %
OXY-2-22 ..........................................................................................................................................................R....E..............................................................................................N...................................  98.97 %
OXY-2-23 .....................................A....................................................................................................................R..............--...........................N.......................................................N...................................  97.93 %
OXY-2-24 .....................................A....................................................................................................................R..............--...........................N.......................................T...............N...................................  97.59 %
OXY-2-25 .....................................A...............................................................................................T....................R...........................................N.......................................T...............N...................................  97.93 %
OXY-2-26 .................................................................................I...............D........................................................R...........................................N.......................................................N...........................T.......  97.93 %
OXY-2-27 ..........................................................H...............................................................................................R.......................................................................................................................................  99.31 %
OXY-2-28 .............-............................................................................................................................................R................................................................................................C......................................  98.97 %
OXY-2-30 .............-............................................................................................................................................R...................................................................................S...................................................  98.97 %
A-OXY-2-like phylogenetic tree

Last updated: November 16, 2022.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu