Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the LEN beta-lactamase family

LEN-1
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280......
MRYVRLCVISLLATLPLVVYAGPQPLEQIKQSESQLSGRVGMVEMDLANGRTLAAWRADERFPMVSTFKVLLCGAVLARVDAGLEQLDRRIHYRQQDLVDYSPVSEKHLVDGMTIGELCAAAITLSDNSAGNLLLATVGGPAGLTAFLRQIGDNVTRLDRWETALNEALPGDARDTTTPASMAATLRKLLTAQHLSARSQQQLLQWMVDDRVAGPLIRAVLPPGWFIADKTGAGERGARGIVALLGPDGKPERIVVIYLRDTPASMAERNQHIAGIGQR-------
LEN-2 .................A.D............................S..................................V.................................................................................................................................................................................................AALIEHWQR  95.45 %
LEN-5 ...I.............A..............................S............................................................T.......................................................................................................................................................................AALIEHWQR  95.45 %
LEN-7 .................A.D............................S..................................V.........................T.......................................................................................................................................................................AALIEHWQR  95.10 %
LEN-8 ....................................P...........S...........................................................................................................H........................................................................................................................AALIEHWQR  95.80 %
LEN-9 ................................................S....................................................................................................................................................................................................................................AALIEHWQR  96.50 %
LEN-10 .................A.D............................S............................................................T..................................................................................................................................................L....................AALIEHWQR  95.10 %
LEN-11 .................A.D............................S.............................................................................................................................................................................A......................................................AALIEHWQR  95.45 %
LEN-12 .................A..............................S.............................................................................................................................................................................A......................................................AALIEHWQR  95.80 %
LEN-13 .................A.D............................S...............................................................................................................................................................................................................L....................AALIEHWQR  95.45 %
LEN-15 ................................................S...................................................................................................................................................P.........................A........................................................-------  98.92 %
LEN-16 .................A..............................S............................................................T.......................................................................................................................................................................AALIEHWQR  95.80 %
LEN-18 .................A.D............................S............................................................T....V.............................................................................................................................................L....................AALIEHWQR  94.76 %
LEN-19 .................A..............................S............................................................T....V..................................................................................................................................................................AALIEHWQR  95.45 %
LEN-20 .................A.D............................S............................................................T....V....................................................................................................................................................V.............AALIEHWQR  94.76 %
LEN-21 .................A.D............................S..................................V...V......................................................................................................................................A......................................................AALIEHWQR  94.76 %
LEN-22 .................A.D............................S...................................................................................................................................................P.........................A......................................................AALIEHWQR  95.10 %
LEN-23 .................A..............................S............................................................T..................................................................................................................................................L....................AALIEHWQR  95.45 %
LEN-24 .............N...A.D............................S....................................................................................................................................................................................................................................AALIEHWQR  95.45 %
LEN-25 .................A.D............................S................................................................A..............................................................................................................................................L....................AALIEHWQR  95.10 %
LEN-26 .............N...A..............................S..................................V.........................T..............M...............................................M.................................................A...........................A.......M.....TI.....Q..A..AALIEHWQR  91.96 %
LEN-27 .................A.D............................S............................................................T.......................................................................................................................................................................AALIEHWQR  95.45 %
LEN-28 .............N...A.D............................S...................................................................................................................................................P.........................A......................................................AALIEHWQR  94.76 %
LEN-30 .............N...A.D............................S............................................................T....V..................................................................................................................................................................AALIEHWQR  94.76 %
LEN-31 .................A.D............................S..................................V.........................T....V.........................................H........................................................................................................................AALIEHWQR  94.41 %
LEN-32 .................A.D............................S..............V............................................................................................H...................................................................................................L....................AALIEHWQR  94.76 %
LEN-33 .................A.D............................S..................................V.........................T....V..................................................................................................................................................................AALIEHWQR  94.76 %
LEN-34 .................A..............................S..................................I.........................T.......................................................................................................................................................................AALIEHWQR  95.45 %
LEN-35 ...I.............A..............................S............................................................T....V..................................................................................................................................................................AALIEHWHD  95.10 %
LEN-36 .................A.D............................S.H................................V.........................T....V..................................................................................................................................................................AALIEHWQR  94.41 %
LEN-37 .................A.D............................S..................................V..................................................................................................S..............................................................................................AALIEHWQR  95.10 %
LEN-38 .............N...A..............................S..................................V........................................M................T..............................M.................................................A...........................A..........................AALIEHWQR  93.71 %
LEN-39 .................A..............................S..................................V.........................T....V.........M..........T....................................M.................................................A...........................A..........................AALIEHWQR  93.36 %
LEN-40 .............N...A..............................S..................................V........................................M................V................................................................................A..........................NA..........................AALIEHWQR  93.71 %
LEN-41 .................A.D............................S..................................V........................................M.................................................................................................A..........................NA..........................AALIEHWQR  94.06 %
LEN-42 .................A..............................S..................................V........................................M...............................................M.................................................A...........................A..........................AALIEHWQR  94.41 %
LEN-43 .............N...A..............................S..................................V........................................M...............................................M.................................................A...........................A..........................AALIEHWQR  94.06 %
LEN-51 ................................................S...............................................................................................................................................................................................................L....................AALIEHWQR  96.15 %
LEN-55 .................A.D............................S....................................................................................................................................................................................................................................AALIEHWQR  95.80 %
LEN-58 .................A.D............................S..................................V.........................F.......................................................................................................................................................................AALIEHWQR  95.10 %
LEN-P5 -------..........A.D............................S............................................................T.................................................................................................................................................................Q.....AALI-----  94.31 %
LEN-P6 -------.........................................S..............................................................................................................................................................................................................................Q.....AALI-----  95.37 %
A-LEN phylogenetic tree

Last updated: November 06, 2021.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu