Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the L2-E-like beta-lactamase family

L2-E-9
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300....
MLARRRFLQFSGAAVASSLLAPALARAVSPASGIPA---AIAGAADFAALEKASGGRLGVTVLNTGNGRRIGGHRQDERFPMCSTFKSLLVAHVLSLADAGRVSLDTRVPIAGKDLLSYAPVARRHVGKDLTVRDLCRGTLTTSDNTAANLLLEVVGGPSALTAFLRGQGDSITRNDRNEPDVNLFVKGDPRDTTSPAAMATSLARFAVGNGLQPASRQQFADWLIDNQTGDACLRAGLGTRWRVGDKTGSNGDDTRNDIAVLWPHAGGAAWVVTAYLQGASVDDDQRAAVLARVGALADAMIG
L2-E-10 ...................F....VQP..AS.....ANA.................................................M.................................................................................................A...............................R.....................K............................T......................-Q..RI..R...  93.75 %
L2-E-13 ...................F.....QP..AS.....ANA.................................................M.................................................................................................A...............................R.....................K............................T..................................  95.72 %
L2-E-28 ..............................S...S.ANA.................................................M.......................E...........................................................V.............A..................................T.................AK...............................................................  96.05 %
L2-E-29 ..............................S...S.ANA.................................................M.......................E...........................................................V.............A..................................T..................K...............................................................  96.38 %
L2-E-31 ..............................S..LS.ANA...D.............................................M.......................E...........................................................V.............A..................................T..................K.............................V.........................T.......  95.07 %
A-L2-E-like phylogenetic tree

Last updated: November 06, 2021.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu