Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the KLUG beta-lactamase family

KLUG-1
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.
MMRHRVKRVMLMTTTCISLLLGSAPLYAQANDVQQKLAALEKSSGGRLGVALIDTADNAQTLYRADERFAMCSTSKVMAAAAVLKQSETQKKVLSQKVEIKSSDLINYNPITEKHVNGTMTLAELSAAALQYSDNTAMNKLIAHLGGPDKVTAFARAIGDNTFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLRNLTLGSALGETQRAQLVTWLKGNTTGAASIQAGLPTSWVVGDKTGSGDYGTTNDIAVIWPEGRAPLILVTYFTQPEQKAESRRDVLAAAAKIVTDGN
KLUG-2 -..KS.R.AI....A.V....A.V....H........................N....T................................DL...R..............A..........G.........................G...........D..............................A.......N...D.......M................................................V.......S.P.............R.....Y  90.03 %
KLUG-3 ...KS.S.AI....A.V....A.V........I....................N....T................................DL...R..............A..........G.........................G.......V...D......................................N...D........................................................V........KP.............R.....Y  90.72 %
KLUG-4 ...KS.R.AI....A.V....A.V........I....................N....T................................DL...R..............A..........G.........................G.......V...D......................................N...D........................................................V.........P.............R.....Y  91.07 %
KLUG-5 ...KS.R.AI....A.V....A.V..C..........................N....T................................DL...R..............A..........G.........................G...........D......................................N...D........................................................V........KP.....G.......R.....Y  90.72 %
A-KLUG phylogenetic tree

Last updated: November 16, 2022.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu