Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the CfxA beta-lactamase family

CfxA
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.
MEKNRKKQIVVLSIALVCIFILVFSLFHKSATKDSANPPLTNVLTDSISQIVSACPGEIGVAVIVNNRDTVKVNNKSVYPMMSVFKVHQALALCNDFDNKGISLDTLVNINRDKLDPKTWSPMLKDYSGPVISLTVRDLLRYTLTQSDNNASNLMFKDMVNVAQTDSFIATLIPRSSFQIAYTEEEMSADHNKAYSNYTSPLGAAMLMNRLFTEGLIDDEKQSFIKNTLKECKTGVDRIAAPLLDKEGVVIAHKTGSGYVNENGVLAAHNDVAYICLPNNISYTLAVFVKDFKGNKSQASQYVAHISAVVYSLLMQTSVKS
CfxA-2 .......................................................................................................................................................................................................................................................................................................E.........................  99.69 %
CfxA-3 ..................................................................................................................................................................................................................................................................D....................................E.........................  99.38 %
CfxA-4 ..................................................................................................................................................................................................................................................................N....................................E.........................  99.38 %
CfxA-5 ..................................................................................................................................................................................................................................................................C....................................E.........................  99.38 %
CfxA-6 .................................G......................................................................................................................................V..............................................................................................................................E.........................  99.07 %
CfxA-7 ...............................................................................................G.......................................................................................................................................................................................................E.........................  99.38 %
CfxA-8 .......................................................................................................................................................................................K..........................W....................................................................................E.........................  99.07 %
CfxA-9 ..............................................................................................................................................................................................................V........................................................................................E.........................  99.38 %
CfxA-10 ....................................................................................................................................................................................................................................F.............................D....................................E.........................  99.07 %
CfxA-11 ........................................................................A..........................................................................................................................................V...................................................................................E.........................  99.07 %
CfxA-P4 ---------------------------------.......................................................................................................................................................................................................................................................V..............E...............----------  85.98 %
CfxA-E-1 .K..........C.............S......G.......D......................I..T...S.....I....................K..L......K...E..........M....A...............S........I...N.L.T........K....................D......................S..SN...D....A.......I...V..................N.....I...Q..........KVC.............E.....F............IN.ALN-  86.60 %
A-CfxA phylogenetic tree

Last updated: November 16, 2022.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu