Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the CTX-M-9-like beta-lactamase family

CTX-M-9
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290........
MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQL------TLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL-
CTX-M-13 .....M.................................................K....................................................................................................E.......................................------.....................................V.........................................................-  98.63 %
CTX-M-16 ....................................................................................................................................................................................................------.............................................G.................................................-  99.66 %
CTX-M-17 ....................................................................................................................................................................................................------.....................................V......................................................K..-  99.31 %
CTX-M-19 .........................................................................................................................................................................S..........................------.....................................V.........................................................-  99.31 %
CTX-M-21 ............GG.G.........F......G...................................................................................................................................................................------.....................................V.........................................................-  97.94 %
CTX-M-24 ....................................................................................................................................................................................................------.....................................V........................................R................-  99.31 %
CTX-M-27 ....................................................................................................................................................................................................------.....................................V.......G.................................................-  99.31 %
CTX-M-38 ....................................................................................................................................................................................................------..........................R..........V.........................................................-  99.31 %
CTX-M-45 ..........S............PT................................................................................................................................................................A..G.DVASLRWVMRWAKPSG.V.DV--------AQRQYDR..G..........V.........................................................-  86.20 %
CTX-M-46 ..............................N...................P.................................................................................................................................................------.....................................V.........................................................-  98.97 %
CTX-M-47 .............................................R......................................................................................................................................................------.....................................V.........................................................-  99.31 %
CTX-M-48 ..............................N.....................................................................................................................................................................------.....................................V.........................................................-  99.31 %
CTX-M-49 .............................................R....P.................................................................................................................................................------.....................................V.........................................................-  98.97 %
CTX-M-50 ..................................................P.................................................................................................................................................------.....................................V.........................................................-  99.31 %
CTX-M-51 ...............................................................................V....................................................................................................................------...............................................................................................-  99.66 %
CTX-M-65 ...............................................................................V....................................................................................................................------.....................................V........................................R................-  98.97 %
CTX-M-67 ............................................................................................................S.......................................................................................------.....................................V.........................................................-  99.31 %
CTX-M-73 ................................M...................................................................................................................................................................------.....................................V.........................................................-  99.31 %
CTX-M-81 ....................................................................................E...............Q.................................H.............................................................------.....................................V.........................................................-  98.63 %
CTX-M-83 ...........................................................H........................................................................................................................................------.....................................V.........................................................-  99.31 %
CTX-M-84 ....................................................................................................................................................................................................------...............A.....................V.........................................................-  99.31 %
CTX-M-85 .........................................................................................................................P..........................................................................------.....................................V.........................................................-  99.31 %
CTX-M-86 ..............................................................................................................F.....................................................................................------.....................................V.........................................................-  99.31 %
CTX-M-87 ...............................................................................V.........................................................................................L..........................------.....................................V.........................................................-  98.97 %
CTX-M-90 ...............................................................................V....................................................................................................................------.....................................V.........................................................-  99.31 %
CTX-M-93 ...........................................................................................................................................................................Q........................------.....................................V.......G.................................................-  98.97 %
CTX-M-98 ...............................................................................V....................................................................................................................------.....................................V.......G.................................................-  98.97 %
CTX-M-99 .........................................................................................................................................................................S..........................------.....................................V........................................R................-  98.97 %
CTX-M-102 ....................................................................................................................................................................................................------...........E.........................V.......G.................................................-  98.97 %
CTX-M-104 ....................................................................................................................................................................................................------.....................................V........................................N................-  99.31 %
CTX-M-105 ...............................................................................V....................................................................................................................------...........E.........................V.......G.................................................-  98.63 %
CTX-M-110 .................................................................................................................E..................................................................................------.....................................V........................................................NL  98.63 %
CTX-M-111 ...................................................................................................................................................Q................................................------.....................................V.........................................................-  99.31 %
CTX-M-112 .............................................................................................................................G......................................................................------.....................................V.........................................................-  99.31 %
CTX-M-113 .....................................................................................R..............................................................................................................------.....................................V.........................................................-  99.31 %
CTX-M-121 ...............................................................................................................T....................................................................................------.....................................V.......G.................................................-  98.97 %
CTX-M-122 ............................................................................................................................................................S.......................................------.....................................V........................................R................-  98.97 %
CTX-M-125 ....................................................................................................................................................................................................------.....................................V........................................H................-  99.31 %
CTX-M-126 .........................................................................................................................................................................A..........................------.....................................V.........................................................-  99.31 %
CTX-M-129 ....................................................................................................................................................................................................------..................R..................V.......G.................................................-  98.97 %
CTX-M-130 ....................................................................................................................................................................................................------.....................................V........................................R.H..............-  98.97 %
CTX-M-134 ....................................................................................................................................................................................................------.....................................V.......S.................................................-  99.31 %
CTX-M-137 ..................................................................................................................................................................................................N.------...K...DS........M..........Q....A..VV.......G............KD....I.........PK............K.VTD..-  93.47 %
CTX-M-140 ...............................................................................................................T....................................................................................------.....................................V.........................................................-  99.31 %
CTX-M-147 ...............................................................................V.........................................................................................S..........................------.....................................V.........................................................-  98.97 %
CTX-M-148 .............................................................................I.V....................................................................................................................------.....................................V........................................R................-  98.63 %
CTX-M-159 ...........................................................................................................................K........................................................................------.....................................V.......G.................................................-  98.97 %
CTX-M-161 ....................................................................................................................................................E...............................................------.....................................V.........................................................-  99.31 %
CTX-M-168 .........................................................................................................................................................................H..........................------.....................................V.........................................................-  99.31 %
CTX-M-174 ......L.............................................................................................................................................................................................------.....................................V.......G.................................................-  98.97 %
CTX-M-191 ......................................................................................................................................D.............................................................------.....................................V.........................................................-  99.31 %
CTX-M-192 ....................................................................................................................................................................................................------.....................................V..R....G.................................................-  98.97 %
CTX-M-195 ............................................................................................................S.......................................................................................------.....................................V.......G.................................................-  98.97 %
CTX-M-196 ....................................................................................................................................................................................................------.....................................V.......G................................R................-  98.97 %
CTX-M-198 ........................A...........................................................................................................................................................................------.....................................V.........................................................-  99.31 %
CTX-M-201 ..........................................................................................................Y.........................................................................................------.....................................V.........................................................-  99.31 %
CTX-M-214 ...............................................................................................................T....................................................................................------...............................................................................................-  99.66 %
CTX-M-215 ......................................................................................................................................D.............................................................------.....................................V........................................H................-  98.97 %
CTX-M-219 .........................................................................................................................................................................S..........................------.....................................V.............................I...........................-  98.97 %
CTX-M-221 .........................................................................................................................................................................S........................N.------...K...DS........M..........Q....A..VV....................KD....I.........PK............K.VTD..-  93.47 %
CTX-M-223 ............................................................................................................S...................V...................................................................------.....................................V.......G.................................................-  98.63 %
CTX-M-233 ................................................................................................................................................................K...................................------.....................................V.......G.................................................-  98.97 %
CTX-M-235 .........................................................................................................I..........................................................................................------.....................................V.........................................................-  99.31 %
CTX-M-239 ....................................................................................................................................G...............................................................------.....................................V..R....G.................................................-  98.63 %
CTX-M-240 ............................................................................................................................................................................S.......................------.....................................V.......G.................................................-  98.97 %
CTX-M-241 ...............................................................................V..........................................................................................--........................------.....................................V.........................................................-  98.63 %
CTX-M-242 ....................................................................................................................................................................................................------............K........................V.......G.................................................-  98.97 %
CTX-M-243 ............................................................................................................S.......................................................................................------.....................................V........................................N................-  98.97 %
CTX-M-P45 ....................................................................................................................................................................................................------.....................................V..R.......................................H.............--  98.63 %
KLUY-1 ....................................................................................................................................................................................................------.....................................V.........................................................-  99.66 %
KLUY-2 ....................................................................................................................................................................................................------.....................................V..................................R......................-  99.31 %
KLUY-3 ....K.................................T.............................................................R.T.............................................................................................------.....................................V.........................................................-  98.28 %
KLUY-4 ....K................S................T.............................................................R.T.............................................................................................------.....................................V.........................................................-  97.94 %
KLUY-5 .....M.................................................E....................................................................................................E.......................................------.....................................V.........................................................-  98.63 %
A-CTX-M-9-like phylogenetic tree

Last updated: November 06, 2021.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu