Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the CKO beta-lactamase family

CKO-1
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290..........
MRNEEVISMWQRMKWGLCVLAALSGSAMAAPLTAQYVSAIAMQEEQRLHARIGIAVLDTATNSITHYRGEERFPLNSTHKPLLCAALLREVDRKALALSASMQFEPSQLVEYSPITEKHVAPDAMSWAQLCSAAVSYSDNTAANLIARKLNGPQAVTQFLRDSGDTITRLDRYEPELNSAIPGDERDSTTPVAIAQTLNTLLLGNVLQPSSREQLMQWMRDDKVADGLLRSVLPDGWKIADKTGAGDNGSRSIVSVVWPTSQKPLLVVIYITQTPATMAQRDAAIVRIGESLFSTLAVYD
CKO-2 .........................................T...........................................................T......................................................................................................................................................................................................  99.33 %
CKO-3 .........................................T...........................................................A......................................................................................................................................................................................................  99.33 %
A-CKO phylogenetic tree

Last updated: November 06, 2021.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu