Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the CARB-17-like beta-lactamase family

CARB-17
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.....
MKKLFLLVGLMVCSTVSYASKL--NEDISLIEKQTSGRIGVSVWDTQTDERWDYRGDERFPLMSTFKTLACATMLSDMDSGKLNKNATARIDERNIVVWSPVMDKLTGQSTRIEHACEAAMLMSDNTAANLVLNEIGGPKAVTLFLRSIGDKATRLDRLEPRLNEAKPGDKRDTTTPNAMVNTLHTLMEDNALSYESRTQLKIWMQDNKVSDSLMRSVLPKGWSIADRSGAGNYGSRGISAMIWKDNYKPVYISIYVTDTDLSLQARDQLIAQISQLILEHYKES
CARB-18 ......................--.................................................................K................A..................................................................................................................................................................................  99.29 %
CARB-19 .......A..............--.................................................................K................A..................................................................................................................................................................................  98.94 %
CARB-20 ......................--..................................................................................A..................................................................................................................................................................................  99.65 %
CARB-21 ......................--.......................M..........................................................A..................................................................................................................................................................................  99.29 %
CARB-22 ......................--.........................K.......................................K................A....................................Q.............................................................................................................................................  98.59 %
CARB-23 ......................NL.................................................................K................A..................................................................................................................................................................................  98.60 %
CARB-24 ......................--.................................................................K................A..............................................................................................................................H...................................................  98.94 %
CARB-25 ......................--.................................................................K................A............................................................................................................................................................................D.....  98.94 %
CARB-26 ......................--.................................................................K................A...............R..................................................................................................................................................................  98.94 %
CARB-27 ......................--.................................................................K...................................................................................................................................................................................................  99.65 %
CARB-28 ......................--.................................................................K................A..................................................................................................................D...............................................................  98.94 %
CARB-29 ......................--.....I...........................................................K................A..................................................................................................................................................................................  98.94 %
CARB-30 ......................--.......................M.........................................K................A...................S..............................................................................................................................................................  98.59 %
CARB-31 ............Y.........--.................................................................K................A..................................................................................................................................................................................  98.94 %
CARB-32 ......................--.......................M..........................................................A.........................................V...................................................................................................................................R....  98.59 %
CARB-33 ......................--......................................................E..........K................A..................................................................................................................................................................................  98.94 %
CARB-34 ......................--.................................................................K................A......................................................G...........................................................................................................................  98.94 %
CARB-35 ......................--.................................................................K................A...........................K......................................................................................................................................................  98.94 %
CARB-36 ......................--.................................................................K................A..............................................................................S...................................................................................................  98.94 %
CARB-38 ......................--.................................................................K................A.................................................................................................................................L................................................  98.94 %
CARB-40 ......................--...................................................................N..............A..................................................................................................................................................................................  99.29 %
CARB-41 ......................--.................................................................K................A.....V............................................................................................................................................................................  98.94 %
CARB-42 .......A.......L....Q.--......L.Q...S..........A........................K..........S.....KV...S...........A..N.................................M...T..........I.......T...S........IL...R..V.GET......V.....................T...........GH.....N.I...E.HR.........E.E.........V........QK..DN  85.16 %
CARB-43 ......................--.................................................................K................A............................................N.....................................................................................................................................  98.94 %
CARB-44 ......................--.................................................................K................A....................................................................................T.............................................................................................  98.94 %
CARB-45 ......................--.A...............................................................K................A......................................................G...........................................................................................................................  98.59 %
CARB-46 ......................--.................................................................K................A............................................E.....................................................................................................................................  98.94 %
CARB-47 ......................--.................................................................K...S............A..................................................................................................................................................................................  98.94 %
CARB-48 ......................--.................................................................K................A..N..........................................T....................................................................................................................................  98.59 %
CARB-56 .......A.......L....Q.--......L.Q...S..........A........................K..........S.....KV...S...........A..N.................................M...T..........I.......T...S........IL...R..I.GET......V.....................T...........GH.....N.I...E.HR.........E.E.........V........QK..DN  85.16 %
CARB-57 .......A.......L....Q.--........Q...S..............................................S.....KV...S...........A..N..V..............................M...T..................T...N.............R..I.GET......V.....................T...........GH.....N.I...E.HR.........E.E..................QK..DN  87.28 %
A-CARB-17-like phylogenetic tree

Last updated: November 06, 2021.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu